(data stored in ACNUC7421 zone)

EMBL: AP011115.PE653

AP011115.PE653       Location/Qualifiers
FT   CDS             complement(677323..677763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48900"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW8"
FT                   /protein_id="BAH48900.1"
FT                   /translation="MAGRFEGTVVIDRPIEEVFEYLAAGVNDREFSPRVQEIVKKTDGP
FT                   PGVGTVFVSTVKDAGMTTKREFEITEFEAPRRIRWAERSTNTVTAKEGGYDLEPSGAGT
FT                   KVTIFNVLEGHGIGRLIAPLALRAARKDAPAFAQRIKVAAEK"
     MAGRFEGTVV IDRPIEEVFE YLAAGVNDRE FSPRVQEIVK KTDGPPGVGT VFVSTVKDAG        60
     MTTKREFEIT EFEAPRRIRW AERSTNTVTA KEGGYDLEPS GAGTKVTIFN VLEGHGIGRL       120
     IAPLALRAAR KDAPAFAQRI KVAAEK                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page