(data stored in ACNUC7421 zone)

EMBL: AP011115.PE654

AP011115.PE654       Location/Qualifiers
FT   CDS             677762..678091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06540"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48901"
FT                   /db_xref="GOA:C1ASW9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW9"
FT                   /protein_id="BAH48901.1"
FT                   /translation="MPASRFRDLPGSDSTRAEAGARSHRRRAVGHRSDAAARTIGETVG
FT                   AFVLIAAVATSRSRYVMATNSPVAEALTSGFQRVLLASSIFLVAAALIALRTGNTRGDC
FT                   TARTK"
     MPASRFRDLP GSDSTRAEAG ARSHRRRAVG HRSDAAARTI GETVGAFVLI AAVATSRSRY        60
     VMATNSPVAE ALTSGFQRVL LASSIFLVAA ALIALRTGNT RGDCTARTK                   109
//

If you have problems or comments...

PBIL Back to PBIL home page