(data stored in ACNUC7421 zone)

EMBL: AP011115.PE656

AP011115.PE656       Location/Qualifiers
FT   CDS             678720..679481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48903"
FT                   /db_xref="GOA:C1ASX1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX1"
FT                   /protein_id="BAH48903.1"
FT                   /translation="MSKAQHVGRLFLVSVLAALAVCGVSVAASAAPPAVTGKILAPALT
FT                   PASGQVVGIAHPVVVRFTSPVPDRALAERGVRITPSTPVPGQFSWIDDRTLQWNPDRFW
FT                   PANTAVTVEAAGARSQFQVGDALVAVANTTTHQFTVSINDQIVQTMPASMGKPGYETPL
FT                   GTFPVIEQFRDMIMDSSTYGVPIDDEEGYRLYVEYATRITWGGIFVHAAPWSVGSQGFE
FT                   NVSHGCINLSTENARWFYDNAKIGDPVIVTS"
     MSKAQHVGRL FLVSVLAALA VCGVSVAASA APPAVTGKIL APALTPASGQ VVGIAHPVVV        60
     RFTSPVPDRA LAERGVRITP STPVPGQFSW IDDRTLQWNP DRFWPANTAV TVEAAGARSQ       120
     FQVGDALVAV ANTTTHQFTV SINDQIVQTM PASMGKPGYE TPLGTFPVIE QFRDMIMDSS       180
     TYGVPIDDEE GYRLYVEYAT RITWGGIFVH AAPWSVGSQG FENVSHGCIN LSTENARWFY       240
     DNAKIGDPVI VTS                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page