(data stored in ACNUC7421 zone)

EMBL: AP011115.PE666

AP011115.PE666       Location/Qualifiers
FT   CDS             complement(689166..690350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06660"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48913"
FT                   /db_xref="GOA:C1ASY1"
FT                   /db_xref="InterPro:IPR022215"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY1"
FT                   /protein_id="BAH48913.1"
FT                   /translation="MKMPALLSRNTETLPGVSGIARVDRNTAKLLRRVGPGDIVVLDEL
FT                   DLDRGTADALVKAGVLAVINASPSISGRYPNLGPEVIVANGILLVDSAGAEIFKSIKDG
FT                   SKVRVNGGGVYSGERRIAKGDEQTEAEISDRMIEAKTGLVDHLEAFSGNTIEFIRTESP
FT                   LLIDGVGVPDVDVDMKERHVVIVSDGPDHASDLKNLKPFIKEYSPILIGVGAGADVLKS
FT                   AGYRPDLIVGDPEDITSATLKSGAEVVLPADQDGHAPGLSRIQDLGIGAMTFPASGSPS
FT                   DLALLLADHHGASLIVTVGSTVSLDEFFDRGRRDSNPSAFMTRLKVGPKLVDAKAVATL
FT                   YRSRVSGSAIALLVLAALVAVIVALVVSNVGGEALDWAVATWNSFALWVQGFFK"
     MKMPALLSRN TETLPGVSGI ARVDRNTAKL LRRVGPGDIV VLDELDLDRG TADALVKAGV        60
     LAVINASPSI SGRYPNLGPE VIVANGILLV DSAGAEIFKS IKDGSKVRVN GGGVYSGERR       120
     IAKGDEQTEA EISDRMIEAK TGLVDHLEAF SGNTIEFIRT ESPLLIDGVG VPDVDVDMKE       180
     RHVVIVSDGP DHASDLKNLK PFIKEYSPIL IGVGAGADVL KSAGYRPDLI VGDPEDITSA       240
     TLKSGAEVVL PADQDGHAPG LSRIQDLGIG AMTFPASGSP SDLALLLADH HGASLIVTVG       300
     STVSLDEFFD RGRRDSNPSA FMTRLKVGPK LVDAKAVATL YRSRVSGSAI ALLVLAALVA       360
     VIVALVVSNV GGEALDWAVA TWNSFALWVQ GFFK                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page