(data stored in ACNUC7421 zone)

EMBL: AP011115.PE675

AP011115.PE675       Location/Qualifiers
FT   CDS             704186..704974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06750"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48922"
FT                   /db_xref="GOA:C1ASZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ0"
FT                   /protein_id="BAH48922.1"
FT                   /translation="MGRIIHHTMNSPSDELRSAMTDAAAIDIRDLHVRRGRNEVLHGID
FT                   VQVASGSITGLLGPSGCGKTTLMRCVVGTQIVESGTVTVLGSPAGSVSLRSRVGYVTQS
FT                   PSVYADLTVRKNVAYFAALYGQPSSAVTEAVDAVGLTRFATQKAADLSGGQLGRVSLAC
FT                   ALVARPEILVLDEPTVGLDPLLRVELWERFEELAAAGTTLLVSSHVMDEAEHCASLLLM
FT                   RDGYVLAQVSPGGLREQTGETSLEDAFLNLIRASHVGSEN"
     MGRIIHHTMN SPSDELRSAM TDAAAIDIRD LHVRRGRNEV LHGIDVQVAS GSITGLLGPS        60
     GCGKTTLMRC VVGTQIVESG TVTVLGSPAG SVSLRSRVGY VTQSPSVYAD LTVRKNVAYF       120
     AALYGQPSSA VTEAVDAVGL TRFATQKAAD LSGGQLGRVS LACALVARPE ILVLDEPTVG       180
     LDPLLRVELW ERFEELAAAG TTLLVSSHVM DEAEHCASLL LMRDGYVLAQ VSPGGLREQT       240
     GETSLEDAFL NLIRASHVGS EN                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page