(data stored in ACNUC7421 zone)

EMBL: AP011115.PE676

AP011115.PE676       Location/Qualifiers
FT   CDS             704974..705729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06760"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48923"
FT                   /db_xref="GOA:C1ASZ1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR004377"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ1"
FT                   /protein_id="BAH48923.1"
FT                   /translation="MNVTIFAATAGRILAQLRTDHRTVAMILVVPSLLMVLLYFLYQNV
FT                   PAPPGQQSLFERVAITMLGILPFVVMFLVTSIAMQRERTSGTLERLLTTPMGKLDLLGG
FT                   YAAAFSTAAAAQAGLACAVAFGFLGLTTEGSVTWVLLIAVLNAILGVALGLLCSAFART
FT                   EFQAVQFMPVVVVPQLFLCGLLVPRDQLPTWLEWISNVLPLSYAVEALQQVATHPGATG
FT                   LMWRDLAVVAAFALLALSLGAATLRRRTP"
     MNVTIFAATA GRILAQLRTD HRTVAMILVV PSLLMVLLYF LYQNVPAPPG QQSLFERVAI        60
     TMLGILPFVV MFLVTSIAMQ RERTSGTLER LLTTPMGKLD LLGGYAAAFS TAAAAQAGLA       120
     CAVAFGFLGL TTEGSVTWVL LIAVLNAILG VALGLLCSAF ARTEFQAVQF MPVVVVPQLF       180
     LCGLLVPRDQ LPTWLEWISN VLPLSYAVEA LQQVATHPGA TGLMWRDLAV VAAFALLALS       240
     LGAATLRRRT P                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page