(data stored in ACNUC7421 zone)

EMBL: AP011115.PE678

AP011115.PE678       Location/Qualifiers
FT   CDS             complement(706353..706565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48925"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ3"
FT                   /protein_id="BAH48925.1"
FT                   /translation="MVIDPTLLGILACPQDKGPLLLVGDELLYNPRLRRAYPIENGIPV
FT                   LLIDEARDVDADEHETLLARASGAA"
     MVIDPTLLGI LACPQDKGPL LLVGDELLYN PRLRRAYPIE NGIPVLLIDE ARDVDADEHE        60
     TLLARASGAA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page