(data stored in ACNUC7421 zone)

EMBL: AP011115.PE679

AP011115.PE679       Location/Qualifiers
FT   CDS             complement(706604..709645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06790"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48926"
FT                   /db_xref="GOA:C1ASZ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ4"
FT                   /protein_id="BAH48926.1"
FT                   /translation="MRAGGSEACVTVRESGRVFVGLNTETVMGPIRRVVATAQNGLEVV
FT                   RLGGLETDLTTSPFEVVERAPMYRLRRYFPDTDPAEAGPPIVLVPPMMMSADVYDVTRD
FT                   QGAVGILRSMGIDPWVVDFGSPDSEEGGWDRNLADHIVAISEIIDQVRSHTGRDVYLSG
FT                   YSQGGMFAYQAAAYRRSRNIAGLVTFGSPVDTLAGLPFGIPAGFATDAAGFLADHVFNR
FT                   LAVSGWMARTGFQLLDPVKTLKSRLDFLRQLHDREALLPREQQRRFLATEGWVAWSGPA
FT                   VAELLKQFIVHNRMMTGGFVIKDQVVSLAELTCPVLAFVGEVDDIGQPLAVRGIRRAAP
FT                   RANVYESTLRAGHFGLVVGSAAATHTWPTTGKWVLWNEGLGPRPTNIELMRYDEHFGSE
FT                   SGVSISDRIIHTVASVAEVGVGVGKGISDFASGALRGTMELSGEATRALPRLARLGQIQ
FT                   PHTQISLSRLLAEQRRKAPGGECFLFDNRVHTYEAVNQRIDNVVRGLIQASVRPAAHVG
FT                   VVMQTRPSALAAIVALSRLGAVAVLLPPGREVHSAIRIDGVERIVTDPENLDAAIATGM
FT                   QVLVLGGGAQRDLDVDPSANVVDLEKIDPGAVTLPGWYRPDPGLARELAFIICSESNGH
FT                   WETKQITNYRWALSAFGTASAADLDRGDTVYCLAPLHHSSSLLAAIGGAVAGGSRIALS
FT                   RGLDAERFAEEVHRYGVTVVSYTWTMMREILDAENLALDGSHPVRLFIGSGMPQGLWRR
FT                   TTERFAPAKVLEFYASTEGDVVLANVAGAKVGAKGRPLPGSAEVRLAAYDPISGRLLED
FT                   EQGFIRECEDDEVGLLLGRAGVHAEMSGGAMRGIFAAGDAWIPTENLFCRDADGDYWLV
FT                   DHRKTVIATPRGAVFTQPIVDALGSVDRVDLAVAYGVEAGGRTLAVAAFTLRDGRPPRL
FT                   AEISDALDALAPALRPDIIQVVGDIPLGSSYRPNADALSAAGLPKPGTRVWYVDPESQQ
FT                   YRRLTKAVAAEFQDGSAGVPAGAR"
     MRAGGSEACV TVRESGRVFV GLNTETVMGP IRRVVATAQN GLEVVRLGGL ETDLTTSPFE        60
     VVERAPMYRL RRYFPDTDPA EAGPPIVLVP PMMMSADVYD VTRDQGAVGI LRSMGIDPWV       120
     VDFGSPDSEE GGWDRNLADH IVAISEIIDQ VRSHTGRDVY LSGYSQGGMF AYQAAAYRRS       180
     RNIAGLVTFG SPVDTLAGLP FGIPAGFATD AAGFLADHVF NRLAVSGWMA RTGFQLLDPV       240
     KTLKSRLDFL RQLHDREALL PREQQRRFLA TEGWVAWSGP AVAELLKQFI VHNRMMTGGF       300
     VIKDQVVSLA ELTCPVLAFV GEVDDIGQPL AVRGIRRAAP RANVYESTLR AGHFGLVVGS       360
     AAATHTWPTT GKWVLWNEGL GPRPTNIELM RYDEHFGSES GVSISDRIIH TVASVAEVGV       420
     GVGKGISDFA SGALRGTMEL SGEATRALPR LARLGQIQPH TQISLSRLLA EQRRKAPGGE       480
     CFLFDNRVHT YEAVNQRIDN VVRGLIQASV RPAAHVGVVM QTRPSALAAI VALSRLGAVA       540
     VLLPPGREVH SAIRIDGVER IVTDPENLDA AIATGMQVLV LGGGAQRDLD VDPSANVVDL       600
     EKIDPGAVTL PGWYRPDPGL ARELAFIICS ESNGHWETKQ ITNYRWALSA FGTASAADLD       660
     RGDTVYCLAP LHHSSSLLAA IGGAVAGGSR IALSRGLDAE RFAEEVHRYG VTVVSYTWTM       720
     MREILDAENL ALDGSHPVRL FIGSGMPQGL WRRTTERFAP AKVLEFYAST EGDVVLANVA       780
     GAKVGAKGRP LPGSAEVRLA AYDPISGRLL EDEQGFIREC EDDEVGLLLG RAGVHAEMSG       840
     GAMRGIFAAG DAWIPTENLF CRDADGDYWL VDHRKTVIAT PRGAVFTQPI VDALGSVDRV       900
     DLAVAYGVEA GGRTLAVAAF TLRDGRPPRL AEISDALDAL APALRPDIIQ VVGDIPLGSS       960
     YRPNADALSA AGLPKPGTRV WYVDPESQQY RRLTKAVAAE FQDGSAGVPA GAR             1013
//

If you have problems or comments...

PBIL Back to PBIL home page