(data stored in ACNUC7421 zone)

EMBL: AP011115.PE68

AP011115.PE68        Location/Qualifiers
FT   CDS             complement(59204..59482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48315"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS66"
FT                   /protein_id="BAH48315.1"
FT                   /translation="MTVPTTNDKPAVHCGGEDRGHRAGNRVVVAAGAFAGHATMSIGML
FT                   VHELSVLVAIVNPMRLFVGGVSAPHITRRPRRARGSEPGFPIRRSNR"
     MTVPTTNDKP AVHCGGEDRG HRAGNRVVVA AGAFAGHATM SIGMLVHELS VLVAIVNPMR        60
     LFVGGVSAPH ITRRPRRARG SEPGFPIRRS NR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page