(data stored in ACNUC7421 zone)

EMBL: AP011115.PE688

AP011115.PE688       Location/Qualifiers
FT   CDS             complement(718328..718726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48935"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT03"
FT                   /protein_id="BAH48935.1"
FT                   /translation="MTEVRDVVAAASQLTDAEFLQVVRAVAAGRPGLGALLAAVDVGAA
FT                   IPTEDPVTAEVVPHVVPGAPAPDYTPGGVPTFDRVRERIEGRFGTATGSSELAHDSPSG
FT                   QSLEEAWEKREKAGKAKLDEIRRSLGKQ"
     MTEVRDVVAA ASQLTDAEFL QVVRAVAAGR PGLGALLAAV DVGAAIPTED PVTAEVVPHV        60
     VPGAPAPDYT PGGVPTFDRV RERIEGRFGT ATGSSELAHD SPSGQSLEEA WEKREKAGKA       120
     KLDEIRRSLG KQ                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page