(data stored in ACNUC7421 zone)

EMBL: AP011115.PE69

AP011115.PE69        Location/Qualifiers
FT   CDS             59502..59858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48316"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS67"
FT                   /protein_id="BAH48316.1"
FT                   /translation="MGPIELVRAYDARGTKKTSPTFLVDRLWPRGIAKADLDCDAWIKE
FT                   VAPSTELRTWFGHQADRFPEFRTRYLQELDTNRTAAQPIVEAARNGTVVLLYSAKDLEH
FT                   NQAVVLREWISNQF"
     MGPIELVRAY DARGTKKTSP TFLVDRLWPR GIAKADLDCD AWIKEVAPST ELRTWFGHQA        60
     DRFPEFRTRY LQELDTNRTA AQPIVEAARN GTVVLLYSAK DLEHNQAVVL REWISNQF         118
//

If you have problems or comments...

PBIL Back to PBIL home page