(data stored in ACNUC7421 zone)

EMBL: AP011115.PE695

AP011115.PE695       Location/Qualifiers
FT   CDS             725106..725489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48942"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT10"
FT                   /protein_id="BAH48942.1"
FT                   /translation="MTDNIDDIPNDGTVSGGDQNTDVRELADVPSVEVISRAAVMLMSS
FT                   AAEKLGLSDADPDSSPHRDLDEARRVITALAGLVTASIEYLGPHAGPIREGLQALQRAF
FT                   REASSHPDEPGKGPGEKYTGPVY"
     MTDNIDDIPN DGTVSGGDQN TDVRELADVP SVEVISRAAV MLMSSAAEKL GLSDADPDSS        60
     PHRDLDEARR VITALAGLVT ASIEYLGPHA GPIREGLQAL QRAFREASSH PDEPGKGPGE       120
     KYTGPVY                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page