(data stored in ACNUC7421 zone)

EMBL: AP011115.PE696

AP011115.PE696       Location/Qualifiers
FT   CDS             725540..725953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48943"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT11"
FT                   /protein_id="BAH48943.1"
FT                   /translation="MAGRNKTEQTQADVDEFLAAVTDPVKRADSARLVELLTAATGEPA
FT                   AMWGTSIVGFGTRHYRYASGHEGDTALIGFSPRAAALTLYLSLDFTEHETELAALGKHK
FT                   VGKGCLYVKKLADVDESVLVSLMDRSVAAARAL"
     MAGRNKTEQT QADVDEFLAA VTDPVKRADS ARLVELLTAA TGEPAAMWGT SIVGFGTRHY        60
     RYASGHEGDT ALIGFSPRAA ALTLYLSLDF TEHETELAAL GKHKVGKGCL YVKKLADVDE       120
     SVLVSLMDRS VAAARAL                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page