(data stored in ACNUC7421 zone)

EMBL: AP011115.PE70

AP011115.PE70        Location/Qualifiers
FT   CDS             complement(60197..61093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00700"
FT                   /product="stomatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48317"
FT                   /db_xref="GOA:C1AS68"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS68"
FT                   /protein_id="BAH48317.1"
FT                   /translation="MILYAVAVIVGLGLLGLSSSIRVVTQFERGVVFRFGRVQPAVRGP
FT                   GLMLLIPIADRLEKVNMQIITMPVPAQDGITRDNVTVRVDAVVYFNVADPVRVAVDVQD
FT                   YVSAIGQVAQTSLRSIIGKSELDDLLSNREGLNQGLELMIDSPALGWGVQIDRVEIKDV
FT                   VLPDSMKRSMSRQAEAERERRARIITADGELQASAKLAQAAETMTEHPAALQLRLLQTV
FT                   VEVAAEKNSTLVLPFPVELLRFLERATPHTAHAPTRTAEPTTTTTPANVNDEPSTRHTQ
FT                   HTPVDARGFALEQSRFG"
     MILYAVAVIV GLGLLGLSSS IRVVTQFERG VVFRFGRVQP AVRGPGLMLL IPIADRLEKV        60
     NMQIITMPVP AQDGITRDNV TVRVDAVVYF NVADPVRVAV DVQDYVSAIG QVAQTSLRSI       120
     IGKSELDDLL SNREGLNQGL ELMIDSPALG WGVQIDRVEI KDVVLPDSMK RSMSRQAEAE       180
     RERRARIITA DGELQASAKL AQAAETMTEH PAALQLRLLQ TVVEVAAEKN STLVLPFPVE       240
     LLRFLERATP HTAHAPTRTA EPTTTTTPAN VNDEPSTRHT QHTPVDARGF ALEQSRFG         298
//

If you have problems or comments...

PBIL Back to PBIL home page