(data stored in ACNUC7421 zone)

EMBL: AP011115.PE700

AP011115.PE700       Location/Qualifiers
FT   CDS             730567..731370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48947"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT15"
FT                   /protein_id="BAH48947.1"
FT                   /translation="MDAQPSGRAMVSRGTDTFCATDGRPATHLPVFDGSLPIMTEQPMV
FT                   IEDSYTGHVSPGSAPQRRTVPGATITKMSVGPMDNNVYLVVCSATGKSVLIDAANEADR
FT                   VNQLIGEHAPSLDLIVTTHQHGDHWLALEDVAAATRVDTAAHPLDADALPVRPDRLLDD
FT                   GDTVTVGEVTLDVIHLAGHTPGSVALALTEAGGGRTHLFTGDSLFPGGVGKTADADKFA
FT                   SLLTDVETKLFDRYGDDTVVYPGHGDDTTLGAERPHLGEWRERGW"
     MDAQPSGRAM VSRGTDTFCA TDGRPATHLP VFDGSLPIMT EQPMVIEDSY TGHVSPGSAP        60
     QRRTVPGATI TKMSVGPMDN NVYLVVCSAT GKSVLIDAAN EADRVNQLIG EHAPSLDLIV       120
     TTHQHGDHWL ALEDVAAATR VDTAAHPLDA DALPVRPDRL LDDGDTVTVG EVTLDVIHLA       180
     GHTPGSVALA LTEAGGGRTH LFTGDSLFPG GVGKTADADK FASLLTDVET KLFDRYGDDT       240
     VVYPGHGDDT TLGAERPHLG EWRERGW                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page