(data stored in ACNUC7421 zone)

EMBL: AP011115.PE701

AP011115.PE701       Location/Qualifiers
FT   CDS             731537..732466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48948"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT16"
FT                   /protein_id="BAH48948.1"
FT                   /translation="MLVRRIARPLLSAIFISGGIDALRNPAQKAQAAAPLIDKSTEALP
FT                   GSVTQKIPSDPETLIKINAAVQIGGGVLLATGKAPRLASLALAGSLVPTTVVGHDFWNE
FT                   TDPAKKAAQRTQFLKNVSLLGGLLIAAVDTEGKPSLGWRGRRAARHAQETVAAALPLGS
FT                   GHDHHGPEIAEALAAASERARILSGEAAERGTGLLEVAKDRGTELAKVAADRGAEWAEV
FT                   AKEHGAEWAEVAKEHGAEWADVARERGAELVEAAKEHGPELAEVAREKGGEWAGTAAER
FT                   GEVLGKRARKQAETALEKARAKRDELSH"
     MLVRRIARPL LSAIFISGGI DALRNPAQKA QAAAPLIDKS TEALPGSVTQ KIPSDPETLI        60
     KINAAVQIGG GVLLATGKAP RLASLALAGS LVPTTVVGHD FWNETDPAKK AAQRTQFLKN       120
     VSLLGGLLIA AVDTEGKPSL GWRGRRAARH AQETVAAALP LGSGHDHHGP EIAEALAAAS       180
     ERARILSGEA AERGTGLLEV AKDRGTELAK VAADRGAEWA EVAKEHGAEW AEVAKEHGAE       240
     WADVARERGA ELVEAAKEHG PELAEVAREK GGEWAGTAAE RGEVLGKRAR KQAETALEKA       300
     RAKRDELSH                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page