(data stored in ACNUC7421 zone)

EMBL: AP011115.PE702

AP011115.PE702       Location/Qualifiers
FT   CDS             732613..734895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48949"
FT                   /db_xref="GOA:C1AT17"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT17"
FT                   /protein_id="BAH48949.1"
FT                   /translation="MPDEDTSRDERELEQQYVTMLYTRLDGLRQYAANRLSRVLLETGG
FT                   TPQARSERESFNQLYTEDLAKYDAAENGLCFGRIDLDGEHRYVGRLGILDEENDYETML
FT                   LDWRAPLARPFYLATPAAPDGVTRRRHIRTRSRRVTAVNDEYLDLAAAEAAGTVTGSDG
FT                   VAGESALLSALNAARTGQMNDIVETIQGEQDAIIRSEHKSVLVVQGGPGTGKTAVALHR
FT                   AAYLLYTYRQQLAKAGVLIIGPNATFLDYIGQVLPSLGETGVLLSTIGDLYPGVRATVE
FT                   DSLDAGEIKGSLDMLDVLKKAVRDRQEVPSRPVELTFDTYRITLDRKVVTRARGRARSS
FT                   RRPHNLARPIFVSSVIEALAQQLADTLGANVVDGGNLLSRDDIADMRDEMREDPAIMTA
FT                   ISALWPELSPQQVLADLYASPKRLADSAPNLTEAQRDSLRRPGMRGFSAADAPLLDELA
FT                   ELLGVDDAAERERARRQWRAQIADAQGALDILTGSAPQDLEDELDPEILMAYDLIDASQ
FT                   LAERHDVGQHQTTAERAAGDRTWTYGHVIVDEAQELSEMAWRMLMRRIPNRWMTLVGDT
FT                   AQTGDPAGTSSWQRILEPYVANRWKLTELTVNYRTPAEIMTSARQVLAEIDPEQTVPRS
FT                   VRESGFAPWALQVSEAELADTVRTCVSRETGPGTTVVIGGHDLVAALADLRSDTVSVLT
FT                   VRDVKGLEFDSVLIAEPQDVLDESPRGMNDLYVALTRATQRLGVVHTKTLPAVLSELGP
FT                   AEVGILS"
     MPDEDTSRDE RELEQQYVTM LYTRLDGLRQ YAANRLSRVL LETGGTPQAR SERESFNQLY        60
     TEDLAKYDAA ENGLCFGRID LDGEHRYVGR LGILDEENDY ETMLLDWRAP LARPFYLATP       120
     AAPDGVTRRR HIRTRSRRVT AVNDEYLDLA AAEAAGTVTG SDGVAGESAL LSALNAARTG       180
     QMNDIVETIQ GEQDAIIRSE HKSVLVVQGG PGTGKTAVAL HRAAYLLYTY RQQLAKAGVL       240
     IIGPNATFLD YIGQVLPSLG ETGVLLSTIG DLYPGVRATV EDSLDAGEIK GSLDMLDVLK       300
     KAVRDRQEVP SRPVELTFDT YRITLDRKVV TRARGRARSS RRPHNLARPI FVSSVIEALA       360
     QQLADTLGAN VVDGGNLLSR DDIADMRDEM REDPAIMTAI SALWPELSPQ QVLADLYASP       420
     KRLADSAPNL TEAQRDSLRR PGMRGFSAAD APLLDELAEL LGVDDAAERE RARRQWRAQI       480
     ADAQGALDIL TGSAPQDLED ELDPEILMAY DLIDASQLAE RHDVGQHQTT AERAAGDRTW       540
     TYGHVIVDEA QELSEMAWRM LMRRIPNRWM TLVGDTAQTG DPAGTSSWQR ILEPYVANRW       600
     KLTELTVNYR TPAEIMTSAR QVLAEIDPEQ TVPRSVRESG FAPWALQVSE AELADTVRTC       660
     VSRETGPGTT VVIGGHDLVA ALADLRSDTV SVLTVRDVKG LEFDSVLIAE PQDVLDESPR       720
     GMNDLYVALT RATQRLGVVH TKTLPAVLSE LGPAEVGILS                             760
//

If you have problems or comments...

PBIL Back to PBIL home page