(data stored in ACNUC7421 zone)

EMBL: AP011115.PE706

AP011115.PE706       Location/Qualifiers
FT   CDS             738791..739309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48953"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR014465"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT21"
FT                   /protein_id="BAH48953.1"
FT                   /translation="MAGASTDIHPPKVEYFDLRDHTNTDPKGFVRHVDHYRVEPWGLYM
FT                   ARTADHRQFHYLESWLLPDLGLRASIFHYHPYHQRDQDHYVDVGTFTRGENVWKSEDHY
FT                   LDLVIRTGRDTELLDVDELMEAHRTGLLDAATAEQAILTATTAIDGIAAHGHDLGGWLA
FT                   SIGMPIDWR"
     MAGASTDIHP PKVEYFDLRD HTNTDPKGFV RHVDHYRVEP WGLYMARTAD HRQFHYLESW        60
     LLPDLGLRAS IFHYHPYHQR DQDHYVDVGT FTRGENVWKS EDHYLDLVIR TGRDTELLDV       120
     DELMEAHRTG LLDAATAEQA ILTATTAIDG IAAHGHDLGG WLASIGMPID WR               172
//

If you have problems or comments...

PBIL Back to PBIL home page