(data stored in ACNUC7421 zone)

EMBL: AP011115.PE713

AP011115.PE713       Location/Qualifiers
FT   CDS             complement(745495..746424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07130"
FT                   /product="putative amino acid ABC transporter amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48960"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT28"
FT                   /protein_id="BAH48960.1"
FT                   /translation="MPVSGRSVFARGRVARTICALAGGSALLLAGCASNTEGGGSPSGE
FT                   DTVAVEVDKVDAIAATLPEKIASSGKIIVGVNIPYSPNEFKDPSGKIVGFDVDLVDAVG
FT                   KVLGVTPEYTEADFDKIIPSIQAGSYDMGMSSFTDTKEREQSVDFTTYFSAGVQWAQPA
FT                   GKSVDPTNACGLRVGVQTTTIEDLEEVPAKSAACVAAGKPPIEIVKFDSQDDAANAVAL
FT                   GKVDAMSADSPVTAYAIKQSDGKIEAAGEVFDAAPYGWPVAKGSPLAQTLQQALQHLID
FT                   DGTYRTIAENWGVEAGVITTSQINGATS"
     MPVSGRSVFA RGRVARTICA LAGGSALLLA GCASNTEGGG SPSGEDTVAV EVDKVDAIAA        60
     TLPEKIASSG KIIVGVNIPY SPNEFKDPSG KIVGFDVDLV DAVGKVLGVT PEYTEADFDK       120
     IIPSIQAGSY DMGMSSFTDT KEREQSVDFT TYFSAGVQWA QPAGKSVDPT NACGLRVGVQ       180
     TTTIEDLEEV PAKSAACVAA GKPPIEIVKF DSQDDAANAV ALGKVDAMSA DSPVTAYAIK       240
     QSDGKIEAAG EVFDAAPYGW PVAKGSPLAQ TLQQALQHLI DDGTYRTIAE NWGVEAGVIT       300
     TSQINGATS                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page