(data stored in ACNUC7421 zone)

EMBL: AP011115.PE715

AP011115.PE715       Location/Qualifiers
FT   CDS             747688..748209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48962"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT30"
FT                   /protein_id="BAH48962.1"
FT                   /translation="MVQSVELLFDEATDVAVRAEWQRLWDAGMPSRTRVRAESNRPHIT
FT                   LFVARHIPPEIDELLGRRIATPSFHVRLGGLVMFGGRHVTLSRLVVPSKALLSLHRSVF
FT                   DLAEHATEVTPHIRPGEWTPHVTLARRLPADQIPEAARLLDGGDIVGRASVVRRWDGDA
FT                   KREWVVTAPP"
     MVQSVELLFD EATDVAVRAE WQRLWDAGMP SRTRVRAESN RPHITLFVAR HIPPEIDELL        60
     GRRIATPSFH VRLGGLVMFG GRHVTLSRLV VPSKALLSLH RSVFDLAEHA TEVTPHIRPG       120
     EWTPHVTLAR RLPADQIPEA ARLLDGGDIV GRASVVRRWD GDAKREWVVT APP              173
//

If you have problems or comments...

PBIL Back to PBIL home page