(data stored in ACNUC7421 zone)

EMBL: AP011115.PE716

AP011115.PE716       Location/Qualifiers
FT   CDS             complement(748210..749115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07160"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48963"
FT                   /db_xref="GOA:C1AT31"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT31"
FT                   /protein_id="BAH48963.1"
FT                   /translation="MRGNPAVQYAGTALAWGASFLFIKVGLEGLSFTQVVLWRLVFGAV
FT                   TLGAVLGITRTRLPRAAATWAHLSVLAVAQCLLPWLLFSWAEQSISSGLASIYNATTPL
FT                   MTMSVALAFLPGEKLTDAKLFGLLLGFGGVVVVLAPWQSGILGSVPAQLACLGATASYG
FT                   VALVYLRRFVLPRGVSTPTIAFMQVSIAAAAMVLATPWAASTPMHLTPAIVASMIGLGA
FT                   FGTGLAFVWNTNVVRGWGPTAASTVTYLTPVVGVALGAVALDERISWNQPVGALAVIAG
FT                   IVVTQRSSRKAAATTAAHTP"
     MRGNPAVQYA GTALAWGASF LFIKVGLEGL SFTQVVLWRL VFGAVTLGAV LGITRTRLPR        60
     AAATWAHLSV LAVAQCLLPW LLFSWAEQSI SSGLASIYNA TTPLMTMSVA LAFLPGEKLT       120
     DAKLFGLLLG FGGVVVVLAP WQSGILGSVP AQLACLGATA SYGVALVYLR RFVLPRGVST       180
     PTIAFMQVSI AAAAMVLATP WAASTPMHLT PAIVASMIGL GAFGTGLAFV WNTNVVRGWG       240
     PTAASTVTYL TPVVGVALGA VALDERISWN QPVGALAVIA GIVVTQRSSR KAAATTAAHT       300
     P                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page