(data stored in ACNUC7421 zone)

EMBL: AP011115.PE72

AP011115.PE72        Location/Qualifiers
FT   CDS             complement(63621..65201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48319"
FT                   /db_xref="GOA:C1AS70"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS70"
FT                   /protein_id="BAH48319.1"
FT                   /translation="MIRWLVIAGAWVLGVASLLLIFLVSSWWLLVTVIAAAIAMVGTWD
FT                   LLQRRHSVLRNYPVIGHARFLLERIRPEIQQYFIERSTDGTPFDRDTRTTVYERAKGTK
FT                   DVEPFGTERDVTATGYEFVTHSLRAHTASDDTPHVRIGGPQCTMGYDIALYNVSAMSFG
FT                   SLSGNAIEALNGGAARGGFAHDTGEGGISPYHLAHGGDLIWEIGSGYFGCRDPDGHFDP
FT                   GEFAAKAALPQVKCISIKLSQGAKPGLGGVLPAAKVSPEIARTRGVPVGQTVISPPSHS
FT                   AFCTPLELIDFITTLRALSGGKPIGFKLCVGSRTEFLAICKAMLETGITPDFIIVDGSE
FT                   GGTGAAPLEFEDHVGMPLTEGLMLVHNALVGTGLRDRIKIGASGKVANGIDIIKRLIQG
FT                   ADFTLAARAMMFAVGCIQAQRCHTNRCPVGVTTQDARRARALHVPDKTTRVYNLQRSTV
FT                   ASAQQILASMGLDDFCDLDPSMLNRRIQGHRTMTYADLHEWLQPGDLLTEDPPTSWLRD
FT                   WTNADSSRF"
     MIRWLVIAGA WVLGVASLLL IFLVSSWWLL VTVIAAAIAM VGTWDLLQRR HSVLRNYPVI        60
     GHARFLLERI RPEIQQYFIE RSTDGTPFDR DTRTTVYERA KGTKDVEPFG TERDVTATGY       120
     EFVTHSLRAH TASDDTPHVR IGGPQCTMGY DIALYNVSAM SFGSLSGNAI EALNGGAARG       180
     GFAHDTGEGG ISPYHLAHGG DLIWEIGSGY FGCRDPDGHF DPGEFAAKAA LPQVKCISIK       240
     LSQGAKPGLG GVLPAAKVSP EIARTRGVPV GQTVISPPSH SAFCTPLELI DFITTLRALS       300
     GGKPIGFKLC VGSRTEFLAI CKAMLETGIT PDFIIVDGSE GGTGAAPLEF EDHVGMPLTE       360
     GLMLVHNALV GTGLRDRIKI GASGKVANGI DIIKRLIQGA DFTLAARAMM FAVGCIQAQR       420
     CHTNRCPVGV TTQDARRARA LHVPDKTTRV YNLQRSTVAS AQQILASMGL DDFCDLDPSM       480
     LNRRIQGHRT MTYADLHEWL QPGDLLTEDP PTSWLRDWTN ADSSRF                      526
//

If you have problems or comments...

PBIL Back to PBIL home page