(data stored in ACNUC7421 zone)

EMBL: AP011115.PE720

AP011115.PE720       Location/Qualifiers
FT   CDS             753705..755105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07200"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48967"
FT                   /db_xref="GOA:C1AT35"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT35"
FT                   /protein_id="BAH48967.1"
FT                   /translation="MAPTVRKRLPAVRTRPTSARKHTRRGPVTRQLGRAFVLVLLGLVA
FT                   AIAFGGPAAAQEPTPPPPPSTSVQPAPPANAVRVSGNLNNAGERLADVEVRALDSSGTE
FT                   VAKATSESNGRWELQVAPGTYTFEIVADSLPDDVSVQGTVEREVVAGRANTVIFSFGEA
FT                   RTGSAVPFYEKLIRQTIDGLRFGLVIAIAGVGLSLIYGTTGLTNFAHGELVTLGAVAAW
FT                   VINVTFGVQLIPATVLAVFVGILIGLLNNAAIWKPLRKRKTGLIAQLVVSIGLAISLRY
FT                   LILIFFSDRAEPFVDYQAQVERHWGPIAITDANLVCIGISLVVLVGVALLLQKTRIGKA
FT                   MRAVSDNRDLAASSGIDVERVIRFVWGLGGGLAALGGVLFGISELGGRVQWEMGFKLLL
FT                   LMFAGITLGGLGTAYGALLGCVIVGLLVQLSTLVINPDLKYIGGLLILIVILVVRPQGI
FT                   LGSRQRIG"
     MAPTVRKRLP AVRTRPTSAR KHTRRGPVTR QLGRAFVLVL LGLVAAIAFG GPAAAQEPTP        60
     PPPPSTSVQP APPANAVRVS GNLNNAGERL ADVEVRALDS SGTEVAKATS ESNGRWELQV       120
     APGTYTFEIV ADSLPDDVSV QGTVEREVVA GRANTVIFSF GEARTGSAVP FYEKLIRQTI       180
     DGLRFGLVIA IAGVGLSLIY GTTGLTNFAH GELVTLGAVA AWVINVTFGV QLIPATVLAV       240
     FVGILIGLLN NAAIWKPLRK RKTGLIAQLV VSIGLAISLR YLILIFFSDR AEPFVDYQAQ       300
     VERHWGPIAI TDANLVCIGI SLVVLVGVAL LLQKTRIGKA MRAVSDNRDL AASSGIDVER       360
     VIRFVWGLGG GLAALGGVLF GISELGGRVQ WEMGFKLLLL MFAGITLGGL GTAYGALLGC       420
     VIVGLLVQLS TLVINPDLKY IGGLLILIVI LVVRPQGILG SRQRIG                      466
//

If you have problems or comments...

PBIL Back to PBIL home page