(data stored in ACNUC7421 zone)

EMBL: AP011115.PE721

AP011115.PE721       Location/Qualifiers
FT   CDS             755110..756099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07210"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48968"
FT                   /db_xref="GOA:C1AT36"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT36"
FT                   /protein_id="BAH48968.1"
FT                   /translation="MDITGALQVSLAQLIGPSAIFYALLAIGLNLHFGYAGLLNFGQIG
FT                   FALLGGYGVGIMTVTYQQPLWVGILVGLAAAGLLAVVLGIPTLRLRADYLAIVTIAASE
FT                   ILRLIFRSTASDSITGSTNGLFGFADPFTTLSPFDSGKQYNFLGVKFYGDDLWSMVVGW
FT                   TLVLVLCGFVYLLTHSPWGRVLKAVREDEDAARALGKNVFVYKMQALVLGGMIGGLGGV
FT                   FNALQTKSINPDFYSTAQTFFAFGALILGGAATVFGPVVGAMLFWFLLAIPDALLRQAI
FT                   SGPEPLLPLTEQQVGAMRFVLLGIMIAVLMIFRPQGILGNKREVQLNA"
     MDITGALQVS LAQLIGPSAI FYALLAIGLN LHFGYAGLLN FGQIGFALLG GYGVGIMTVT        60
     YQQPLWVGIL VGLAAAGLLA VVLGIPTLRL RADYLAIVTI AASEILRLIF RSTASDSITG       120
     STNGLFGFAD PFTTLSPFDS GKQYNFLGVK FYGDDLWSMV VGWTLVLVLC GFVYLLTHSP       180
     WGRVLKAVRE DEDAARALGK NVFVYKMQAL VLGGMIGGLG GVFNALQTKS INPDFYSTAQ       240
     TFFAFGALIL GGAATVFGPV VGAMLFWFLL AIPDALLRQA ISGPEPLLPL TEQQVGAMRF       300
     VLLGIMIAVL MIFRPQGILG NKREVQLNA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page