(data stored in ACNUC7421 zone)

EMBL: AP011115.PE722

AP011115.PE722       Location/Qualifiers
FT   CDS             756092..757111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07220"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48969"
FT                   /db_xref="GOA:C1AT37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT37"
FT                   /protein_id="BAH48969.1"
FT                   /translation="MPDHRLPDHLQTDTVLTAEERASIFTDVPHSPGAAKPDPILLVDN
FT                   VSRTFGGLRAVDVAHLEIQRGCITGLIGPNGAGKTTLFNLLTGFDRPDSGTWSMDGQSL
FT                   GRMYPHQVARRGVVRTFQLTKALSKLTVLDNVRLGATGQRGERIFNTLLPWTWKAQERA
FT                   VTERANELLARFKLDTKSDDLAGSLSGGQRKLLEMARALMTEPTVVMLDEPMAGVNPAL
FT                   TQSLLGHIKSLRDEGMTVVFVEHDMDVIRDISDWVVVMAQGSVIAESTPEHLSSNSAVV
FT                   DAYLGSHHDQALEFDDEGNPVGATAVLAEALESAEAETLETGGDLSEPDITELRRENP"
     MPDHRLPDHL QTDTVLTAEE RASIFTDVPH SPGAAKPDPI LLVDNVSRTF GGLRAVDVAH        60
     LEIQRGCITG LIGPNGAGKT TLFNLLTGFD RPDSGTWSMD GQSLGRMYPH QVARRGVVRT       120
     FQLTKALSKL TVLDNVRLGA TGQRGERIFN TLLPWTWKAQ ERAVTERANE LLARFKLDTK       180
     SDDLAGSLSG GQRKLLEMAR ALMTEPTVVM LDEPMAGVNP ALTQSLLGHI KSLRDEGMTV       240
     VFVEHDMDVI RDISDWVVVM AQGSVIAEST PEHLSSNSAV VDAYLGSHHD QALEFDDEGN       300
     PVGATAVLAE ALESAEAETL ETGGDLSEPD ITELRRENP                              339
//

If you have problems or comments...

PBIL Back to PBIL home page