(data stored in ACNUC7421 zone)

EMBL: AP011115.PE723

AP011115.PE723       Location/Qualifiers
FT   CDS             757108..757902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07230"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48970"
FT                   /db_xref="GOA:C1AT38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT38"
FT                   /protein_id="BAH48970.1"
FT                   /translation="MTEPTPAEFAATPEEHARLAEGALVRADGVVAGYIPGVNILRECN
FT                   FFLREGEIVGIIGPNGAGKSTLLKSLFGLIPVREGSVTLRGEDITSKPAHVLVQMGVGY
FT                   VPQTQNVFPSLTIEENLEMGVYLRPKLFAERFAFVGDLFPLLVERKKVKAGALSGGERQ
FT                   MVAMGRALMMDPSVLLLDEPSAGLSPMFQDEVFIRCKRINAAGVSVIMVEQNARRCLQI
FT                   CDRGYVLDQGRNAYTDSGPNLMHDPKVIELYLGTLAGSQEKK"
     MTEPTPAEFA ATPEEHARLA EGALVRADGV VAGYIPGVNI LRECNFFLRE GEIVGIIGPN        60
     GAGKSTLLKS LFGLIPVREG SVTLRGEDIT SKPAHVLVQM GVGYVPQTQN VFPSLTIEEN       120
     LEMGVYLRPK LFAERFAFVG DLFPLLVERK KVKAGALSGG ERQMVAMGRA LMMDPSVLLL       180
     DEPSAGLSPM FQDEVFIRCK RINAAGVSVI MVEQNARRCL QICDRGYVLD QGRNAYTDSG       240
     PNLMHDPKVI ELYLGTLAGS QEKK                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page