(data stored in ACNUC7421 zone)

EMBL: AP011115.PE724

AP011115.PE724       Location/Qualifiers
FT   CDS             complement(757972..759294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07240"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48971"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT39"
FT                   /protein_id="BAH48971.1"
FT                   /translation="MAKRTLVRAAAVLGAASLALAGCSSDSGDDSASGSDSSASATTVS
FT                   TDCTPEEAAAAGAPSTAPLKIGTLLPDTGSLSFLGPPMVAGTQLGVNDVNAAGGVLGQP
FT                   VQLIPGDSGDTTTDTANTTVDRELAAGTQVIIGAASSSVSLKVIDKVSSAGVVMFSPAN
FT                   TSDQFVCYPDKGQYFRTAPTDVLQAQAVSQLISDDGGQRVSILALNDPYGTGLADNIQK
FT                   NLVDAGIPEDQIQKIIYDPNAQSFNSEVDQVKDFAPDAVAVVGFEESAKIITRMHEVGI
FT                   GPSDGMKVYGVDGNMGNALGESVAAPLLDGMQGTTPLTDVGPAFQDRLKAINPGLIDFN
FT                   YAGESYDAVVISALAAEAGKSTAGRDIAANINNVTEGGTPCTSYQECLPLVQAGTDIDY
FT                   NGITGKLDFAAAGEPSIGSYGKLKFGADNKLTTDGYIVVGG"
     MAKRTLVRAA AVLGAASLAL AGCSSDSGDD SASGSDSSAS ATTVSTDCTP EEAAAAGAPS        60
     TAPLKIGTLL PDTGSLSFLG PPMVAGTQLG VNDVNAAGGV LGQPVQLIPG DSGDTTTDTA       120
     NTTVDRELAA GTQVIIGAAS SSVSLKVIDK VSSAGVVMFS PANTSDQFVC YPDKGQYFRT       180
     APTDVLQAQA VSQLISDDGG QRVSILALND PYGTGLADNI QKNLVDAGIP EDQIQKIIYD       240
     PNAQSFNSEV DQVKDFAPDA VAVVGFEESA KIITRMHEVG IGPSDGMKVY GVDGNMGNAL       300
     GESVAAPLLD GMQGTTPLTD VGPAFQDRLK AINPGLIDFN YAGESYDAVV ISALAAEAGK       360
     STAGRDIAAN INNVTEGGTP CTSYQECLPL VQAGTDIDYN GITGKLDFAA AGEPSIGSYG       420
     KLKFGADNKL TTDGYIVVGG                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page