(data stored in ACNUC7421 zone)

EMBL: AP011115.PE726

AP011115.PE726       Location/Qualifiers
FT   CDS             complement(760469..760921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07260"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48973"
FT                   /db_xref="GOA:C1AT41"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT41"
FT                   /protein_id="BAH48973.1"
FT                   /translation="MKARMTNPAMLVPDAMKSLLALGKATAKANVPPVTHALVHLRSSQ
FT                   INGCSVCVDMHARELEKEGETNQRIFAVAAWREAPFFSDAERAALALAEAMTRLSDRPD
FT                   PVPDEVWDEAARHYDEEQLASLVLSIAGVNLWNRLNAATRQVAGQW"
     MKARMTNPAM LVPDAMKSLL ALGKATAKAN VPPVTHALVH LRSSQINGCS VCVDMHAREL        60
     EKEGETNQRI FAVAAWREAP FFSDAERAAL ALAEAMTRLS DRPDPVPDEV WDEAARHYDE       120
     EQLASLVLSI AGVNLWNRLN AATRQVAGQW                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page