(data stored in ACNUC7421 zone)

EMBL: AP011115.PE728

AP011115.PE728       Location/Qualifiers
FT   CDS             762017..762520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48975"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT43"
FT                   /protein_id="BAH48975.1"
FT                   /translation="MELGTVTFTYDGRVALRFQQALSHSPEKVWRVLTDPQYLKAWFPA
FT                   DVDFDLTPGADLVFRVTPEQVRRFGLPADQTTTGTVISVHPAHILEYLWDAETLHWELV
FT                   PDGSGGCWLTLTHTVEEEESAYAHAAGWHAGLEVVEAQLDGREVDWSLWDRADELASSY
FT                   RKTS"
     MELGTVTFTY DGRVALRFQQ ALSHSPEKVW RVLTDPQYLK AWFPADVDFD LTPGADLVFR        60
     VTPEQVRRFG LPADQTTTGT VISVHPAHIL EYLWDAETLH WELVPDGSGG CWLTLTHTVE       120
     EEESAYAHAA GWHAGLEVVE AQLDGREVDW SLWDRADELA SSYRKTS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page