(data stored in ACNUC7421 zone)

EMBL: AP011115.PE729

AP011115.PE729       Location/Qualifiers
FT   CDS             762539..763636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48976"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT44"
FT                   /protein_id="BAH48976.1"
FT                   /translation="MRIPDSTTTPAATFVKEVTGEATRRWGVHGTDLGCPVRLADGRVA
FT                   FFFGDTFTSRGRSGTGWRSPVMLRSTTTDLRGGIEFDSAAGGRTAREILPNAHDVRESP
FT                   DRESAGTEFTVVPADAVTIGDRTYLSVVSVHSWAAQAWPTNFTYLAWSDDGGEHWHRTR
FT                   ARWDNHGGSLDQLWTMERHDGYVYVVSSAFDRINPGGMILRRVPEARILEPGAYEDWGW
FT                   DRGTGWAWGQPATPILPGPVGEMCLRQIDGTWVLAYFDPTAYAIVTRTARRIDGPWSEP
FT                   TVQVAGGGWGAADGTWAQIYGGYIHPASTRDELHLLVSQWNTTTGDPYRVLQFTTPLDP
FT                   PVTPRAPTPTTALPLRVPHRGNGIG"
     MRIPDSTTTP AATFVKEVTG EATRRWGVHG TDLGCPVRLA DGRVAFFFGD TFTSRGRSGT        60
     GWRSPVMLRS TTTDLRGGIE FDSAAGGRTA REILPNAHDV RESPDRESAG TEFTVVPADA       120
     VTIGDRTYLS VVSVHSWAAQ AWPTNFTYLA WSDDGGEHWH RTRARWDNHG GSLDQLWTME       180
     RHDGYVYVVS SAFDRINPGG MILRRVPEAR ILEPGAYEDW GWDRGTGWAW GQPATPILPG       240
     PVGEMCLRQI DGTWVLAYFD PTAYAIVTRT ARRIDGPWSE PTVQVAGGGW GAADGTWAQI       300
     YGGYIHPAST RDELHLLVSQ WNTTTGDPYR VLQFTTPLDP PVTPRAPTPT TALPLRVPHR       360
     GNGIG                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page