(data stored in ACNUC7421 zone)

EMBL: AP011115.PE730

AP011115.PE730       Location/Qualifiers
FT   CDS             complement(763563..765350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07300"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48977"
FT                   /db_xref="GOA:C1AT45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT45"
FT                   /protein_id="BAH48977.1"
FT                   /translation="MDWNNVVWDSSMWLLKAYVMTVVAFVVVVILLARFTKWGRQFWRF
FT                   AAPYFNPRRSLKPLTILAVLLLSTVFAVRMTVLFSYWYNDFYDSIQNLDESAFWHFLRV
FT                   FAILATVHVVRALVEYLIGQTLDIDWRTWLNHHLVDDWLDSRAYYRDRFLGDAIDNPDQ
FT                   RIQADITNFVTTSRSLSMGAVTAVLSIVSFTGILWDLSGPMTVFGVEISRAMIFLVYIY
FT                   VLVTTVVAFWIGKPLIKLNFLNEKLGANFRYALIRVREYGESIAFYRGENVERRTLARR
FT                   FADVIRNMWQIVFRTLKFSGWNLTVNQTAVIFPFLVQGPRLFTGQVSLGDVMQTSQAFG
FT                   QVHDSLSFFRESYADFASFRATLIRLNGLANDNQHAAELPVLKTGKSGDDLQVEKLDVR
FT                   IPTGETLIEGLALTVTPGQSLLVKGPSGSGKTTLLRTLADLWPYADGTVSRPSGEAIFL
FT                   SQRPYLPLGSLRTALAYPKEPTASDDVVRGALSRVSLGNLGDRLDETADWTRILSPGEQ
FT                   QRLAFARVLIARPAVIFLDEATSAIDEGLEHTLYTLLRTELPDSIVVSVGHRSTLNQFH
FT                   SRGVELEGEGRWSESELVG"
     MDWNNVVWDS SMWLLKAYVM TVVAFVVVVI LLARFTKWGR QFWRFAAPYF NPRRSLKPLT        60
     ILAVLLLSTV FAVRMTVLFS YWYNDFYDSI QNLDESAFWH FLRVFAILAT VHVVRALVEY       120
     LIGQTLDIDW RTWLNHHLVD DWLDSRAYYR DRFLGDAIDN PDQRIQADIT NFVTTSRSLS       180
     MGAVTAVLSI VSFTGILWDL SGPMTVFGVE ISRAMIFLVY IYVLVTTVVA FWIGKPLIKL       240
     NFLNEKLGAN FRYALIRVRE YGESIAFYRG ENVERRTLAR RFADVIRNMW QIVFRTLKFS       300
     GWNLTVNQTA VIFPFLVQGP RLFTGQVSLG DVMQTSQAFG QVHDSLSFFR ESYADFASFR       360
     ATLIRLNGLA NDNQHAAELP VLKTGKSGDD LQVEKLDVRI PTGETLIEGL ALTVTPGQSL       420
     LVKGPSGSGK TTLLRTLADL WPYADGTVSR PSGEAIFLSQ RPYLPLGSLR TALAYPKEPT       480
     ASDDVVRGAL SRVSLGNLGD RLDETADWTR ILSPGEQQRL AFARVLIARP AVIFLDEATS       540
     AIDEGLEHTL YTLLRTELPD SIVVSVGHRS TLNQFHSRGV ELEGEGRWSE SELVG            595
//

If you have problems or comments...

PBIL Back to PBIL home page