(data stored in ACNUC7421 zone)

EMBL: AP011115.PE731

AP011115.PE731       Location/Qualifiers
FT   CDS             complement(765445..765747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48978"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT46"
FT                   /protein_id="BAH48978.1"
FT                   /translation="MAAAYGRSGISETERTCTMSADEPEQKKTGRPAESEVPVPDDEAL
FT                   AEARKKVEEIDARYEPGARETVVLPGSDGTVSGTAFDDYVDDDGNLKEPEPEKGS"
     MAAAYGRSGI SETERTCTMS ADEPEQKKTG RPAESEVPVP DDEALAEARK KVEEIDARYE        60
     PGARETVVLP GSDGTVSGTA FDDYVDDDGN LKEPEPEKGS                             100
//

If you have problems or comments...

PBIL Back to PBIL home page