(data stored in ACNUC7421 zone)

EMBL: AP011115.PE736

AP011115.PE736       Location/Qualifiers
FT   CDS             complement(774485..775324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48983"
FT                   /db_xref="GOA:C1AT51"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT51"
FT                   /protein_id="BAH48983.1"
FT                   /translation="MTEPGKASDESGTGASDDAPKVDLGKSSDGTENSSDSSLPPEFGS
FT                   PFDYDATAEASLSQPPATSDATPSPGASGTGPGWDTYSGVGNGPGWGSTPTYPPPGGTE
FT                   PTAPFPNVGESTSPTAPYSGYDKPQQPDGPTYGAPDPAYGAQYGAAPQPPQDYQQPGYQ
FT                   QPAYGQQQGYPQQGFPPPGYAPGYNAYADPSAPFGRHPLTGEPYSDKSKLTAGLLQIFL
FT                   GAFGVGRFYLNQPGIAVAQIAVTWLTCGIGGIWPLVDGIMMLTGSVKDQYGRPLRDQ"
     MTEPGKASDE SGTGASDDAP KVDLGKSSDG TENSSDSSLP PEFGSPFDYD ATAEASLSQP        60
     PATSDATPSP GASGTGPGWD TYSGVGNGPG WGSTPTYPPP GGTEPTAPFP NVGESTSPTA       120
     PYSGYDKPQQ PDGPTYGAPD PAYGAQYGAA PQPPQDYQQP GYQQPAYGQQ QGYPQQGFPP       180
     PGYAPGYNAY ADPSAPFGRH PLTGEPYSDK SKLTAGLLQI FLGAFGVGRF YLNQPGIAVA       240
     QIAVTWLTCG IGGIWPLVDG IMMLTGSVKD QYGRPLRDQ                              279
//

If you have problems or comments...

PBIL Back to PBIL home page