(data stored in ACNUC7421 zone)

EMBL: AP011115.PE741

AP011115.PE741       Location/Qualifiers
FT   CDS             complement(779423..780127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07410"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48988"
FT                   /db_xref="GOA:C1AT56"
FT                   /db_xref="InterPro:IPR011746"
FT                   /db_xref="InterPro:IPR019051"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT56"
FT                   /protein_id="BAH48988.1"
FT                   /translation="MSDASEPAREPARAGRRRSMFAVLLLAVAAVCLWGASRMTWVEVT
FT                   SSDGLGEERTSVLVGGTWAAALTPLALTLVAAIAASFAVKGWALRVLGVLVAVVAVAAA
FT                   VPAVGLLVSGASDDEAARLAELPGRAEVQSVSVHAAPAVLVLVGALAALAAAVELVRRP
FT                   RVRAGLSSKYDSPGARRDAAKKTGADSAGEPVTQRMLWDALDAGEDPTVDDKKAEPVDQ
FT                   VDGSDEDPGTRT"
     MSDASEPARE PARAGRRRSM FAVLLLAVAA VCLWGASRMT WVEVTSSDGL GEERTSVLVG        60
     GTWAAALTPL ALTLVAAIAA SFAVKGWALR VLGVLVAVVA VAAAVPAVGL LVSGASDDEA       120
     ARLAELPGRA EVQSVSVHAA PAVLVLVGAL AALAAAVELV RRPRVRAGLS SKYDSPGARR       180
     DAAKKTGADS AGEPVTQRML WDALDAGEDP TVDDKKAEPV DQVDGSDEDP GTRT             234
//

If you have problems or comments...

PBIL Back to PBIL home page