(data stored in ACNUC7421 zone)

EMBL: AP011115.PE744

AP011115.PE744       Location/Qualifiers
FT   CDS             complement(782222..783001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48991"
FT                   /db_xref="GOA:C1ATY3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C1ATY3"
FT                   /protein_id="BAH48991.1"
FT                   /translation="MTNAMPALFLSHGAPPLVDSDLWVSQLAKWAGDLPRPTAILMVSA
FT                   HWESAPLTIGSTTTGTPLVYDFGGFPERFYRTTYESPGAPELAAQVVSLMPDDETVSHQ
FT                   PHRGLDHGAYVPLTVMYPDADIPVLQISLPTLDPQRLLHLGERLRPLREQGVLIVGSGF
FT                   TTHGLPFLRDPSPDATAPGWSSEFDAWADERLAAGDVDSLIDFRSLAPGMPYAHPTIEH
FT                   FAPLFVTLGASSDPEQIPRQVIDGFWMGLAKRSIQVA"
     MTNAMPALFL SHGAPPLVDS DLWVSQLAKW AGDLPRPTAI LMVSAHWESA PLTIGSTTTG        60
     TPLVYDFGGF PERFYRTTYE SPGAPELAAQ VVSLMPDDET VSHQPHRGLD HGAYVPLTVM       120
     YPDADIPVLQ ISLPTLDPQR LLHLGERLRP LREQGVLIVG SGFTTHGLPF LRDPSPDATA       180
     PGWSSEFDAW ADERLAAGDV DSLIDFRSLA PGMPYAHPTI EHFAPLFVTL GASSDPEQIP       240
     RQVIDGFWMG LAKRSIQVA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page