(data stored in ACNUC7421 zone)

EMBL: AP011115.PE77

AP011115.PE77        Location/Qualifiers
FT   CDS             complement(68973..69686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48324"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS75"
FT                   /protein_id="BAH48324.1"
FT                   /translation="MSTPRSAAPAVLAALSNLDDPLRRRLYDYVTESGAPVSREQAAAA
FT                   VDVGRTLAAYHLDKLADADLVTVSYQRPAGRGGPGAGRPAKLYTRATTEMTVSVPPRDY
FT                   ELLARLLVTSVEQDTSGTVRAAVNEAALDAGKRAAADTGGDLLAALRGCGYLPQVGDDG
FT                   RIDLRNCPFHHVARDHLDVVCGLNLRLVQGVIAGSAGHDAHAELDPRPDRCCVVVHHAA
FT                   SAHAHSPPPPGPARP"
     MSTPRSAAPA VLAALSNLDD PLRRRLYDYV TESGAPVSRE QAAAAVDVGR TLAAYHLDKL        60
     ADADLVTVSY QRPAGRGGPG AGRPAKLYTR ATTEMTVSVP PRDYELLARL LVTSVEQDTS       120
     GTVRAAVNEA ALDAGKRAAA DTGGDLLAAL RGCGYLPQVG DDGRIDLRNC PFHHVARDHL       180
     DVVCGLNLRL VQGVIAGSAG HDAHAELDPR PDRCCVVVHH AASAHAHSPP PPGPARP          237
//

If you have problems or comments...

PBIL Back to PBIL home page