(data stored in ACNUC7421 zone)

EMBL: AP011115.PE80

AP011115.PE80        Location/Qualifiers
FT   CDS             complement(71131..71700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48327"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS78"
FT                   /protein_id="BAH48327.1"
FT                   /translation="MWSPVGGGGEAMLLSVGHGRLGREELTTLLNRAGVDAVVDIRRYP
FT                   GSRRNRDVGSEMMTHWLPDAGIGYRWESRLGGRRRLSPGEPREDPWWQVDQFAAYAAHT
FT                   RTTEFAVALTELLDRAARQRTAMMCSESVWWRCHRRLVADVAVLRRGVSVEHLMHDGRR
FT                   TPHLPAEGARVRADGQVVWDRHRARS"
     MWSPVGGGGE AMLLSVGHGR LGREELTTLL NRAGVDAVVD IRRYPGSRRN RDVGSEMMTH        60
     WLPDAGIGYR WESRLGGRRR LSPGEPREDP WWQVDQFAAY AAHTRTTEFA VALTELLDRA       120
     ARQRTAMMCS ESVWWRCHRR LVADVAVLRR GVSVEHLMHD GRRTPHLPAE GARVRADGQV       180
     VWDRHRARS                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page