(data stored in ACNUC7421 zone)

EMBL: AP011115.PE86

AP011115.PE86        Location/Qualifiers
FT   CDS             75267..75932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48333"
FT                   /db_xref="GOA:C1AS84"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS84"
FT                   /protein_id="BAH48333.1"
FT                   /translation="MPSLTPGEPTRTDLATRTDIEDVLRRFYGRVLVDDLLAVPFAEIR
FT                   ESGLESRLPIMCDFWETVLFGARLYQGSAGRVHRSVHTRHRFEAWHFLRWLTLWSTTVG
FT                   QMFHGPSAAHATVHATRIARAMHRNLTGTDSAELDALTTREPHRVRDDHPSDRSPGGDL
FT                   DDGTASHRRVHGEATDLPEDHHTPRRTDQTVAADKPPGVASVDSDGPRRRIRKEVLQP"
     MPSLTPGEPT RTDLATRTDI EDVLRRFYGR VLVDDLLAVP FAEIRESGLE SRLPIMCDFW        60
     ETVLFGARLY QGSAGRVHRS VHTRHRFEAW HFLRWLTLWS TTVGQMFHGP SAAHATVHAT       120
     RIARAMHRNL TGTDSAELDA LTTREPHRVR DDHPSDRSPG GDLDDGTASH RRVHGEATDL       180
     PEDHHTPRRT DQTVAADKPP GVASVDSDGP RRRIRKEVLQ P                           221
//

If you have problems or comments...

PBIL Back to PBIL home page