(data stored in ACNUC7421 zone)

EMBL: AP011115.PE87

AP011115.PE87        Location/Qualifiers
FT   CDS             75929..76240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48334"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS85"
FT                   /protein_id="BAH48334.1"
FT                   /translation="MNEKTWSVNIVIDEHKSAETGAQTRARARLRTSGRAAFVGTGLAR
FT                   RNPHHTDVPEVSDDMAAARALADLSHQLYEAAAQREAVTRSALTSARAADFGRRRSSA"
     MNEKTWSVNI VIDEHKSAET GAQTRARARL RTSGRAAFVG TGLARRNPHH TDVPEVSDDM        60
     AAARALADLS HQLYEAAAQR EAVTRSALTS ARAADFGRRR SSA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page