(data stored in ACNUC7421 zone)

EMBL: AP011115.PE88

AP011115.PE88        Location/Qualifiers
FT   CDS             76333..76743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48335"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS86"
FT                   /protein_id="BAH48335.1"
FT                   /translation="MSEHLFHIALADDWEGAARFGEYEASTRAHTLDQIGFIHAATAEQ
FT                   LEHVLATVYGDVNLPLAVIVIDQDALRDAGVDVRWDERAGPSDTPGRWVPRIMGAVPLD
FT                   PDIVVATIPLEKHGENWTVPDLSGYSVDEAAS"
     MSEHLFHIAL ADDWEGAARF GEYEASTRAH TLDQIGFIHA ATAEQLEHVL ATVYGDVNLP        60
     LAVIVIDQDA LRDAGVDVRW DERAGPSDTP GRWVPRIMGA VPLDPDIVVA TIPLEKHGEN       120
     WTVPDLSGYS VDEAAS                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page