(data stored in ACNUC7421 zone)

EMBL: AP011115.PE89

AP011115.PE89        Location/Qualifiers
FT   CDS             complement(77092..77880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48336"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS87"
FT                   /protein_id="BAH48336.1"
FT                   /translation="MKGDEVDEASDARGPRRNFLPRNRQRERVLRMVREHEGAVDAVEL
FT                   ASQIGVHVTTVRFHLDALCDDGAITRTRMNRPGAGRPRTGYLAIEERVDYRTLADVLAM
FT                   ELGQTVQTRARRAEHAGHEWATRMAASRSAGTGDGGHTPESDAGDALDHAAARTTNAFA
FT                   RMGFGPELVSAPDPSTPPSADSGGPAGERERIIRLHACPVRDLARSHPEVVCGVHRGLL
FT                   QGLLNTSTTEGNRKPHQPALSAHLEPFVEPELCVARLVAG"
     MKGDEVDEAS DARGPRRNFL PRNRQRERVL RMVREHEGAV DAVELASQIG VHVTTVRFHL        60
     DALCDDGAIT RTRMNRPGAG RPRTGYLAIE ERVDYRTLAD VLAMELGQTV QTRARRAEHA       120
     GHEWATRMAA SRSAGTGDGG HTPESDAGDA LDHAAARTTN AFARMGFGPE LVSAPDPSTP       180
     PSADSGGPAG ERERIIRLHA CPVRDLARSH PEVVCGVHRG LLQGLLNTST TEGNRKPHQP       240
     ALSAHLEPFV EPELCVARLV AG                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page