(data stored in ACNUC7421 zone)

EMBL: AP011115.PE90

AP011115.PE90        Location/Qualifiers
FT   CDS             77945..78847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48337"
FT                   /db_xref="GOA:C1AS88"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS88"
FT                   /protein_id="BAH48337.1"
FT                   /translation="MTVDTICDPDIPMTTQVELFGPEFTQFVLPYQCAISTMTTKVHIL
FT                   RKGFTHLDRHCPIEHVSARVKSPDSIMAKAQRLRCPLTVSHIRQNIRDIAGVRITCGLI
FT                   SDTYRVADLIGGQPDVTVLEVEDYIAKPKSNGYKSLHMAIEIPVFLSDRVVQVPVELQI
FT                   RTIAMDFWASLEHKIYYKYKRSVPRRLLQELTEAADVAHRLDRKMERLHNEVAGLKSVV
FT                   DSDGPLSLEATDHDHGDRSQNRCGKPHNSTAGPLVRNPPAGGVDVCRNTTHLTDAVLQG
FT                   NTRVGPSTAPTACRRNPNP"
     MTVDTICDPD IPMTTQVELF GPEFTQFVLP YQCAISTMTT KVHILRKGFT HLDRHCPIEH        60
     VSARVKSPDS IMAKAQRLRC PLTVSHIRQN IRDIAGVRIT CGLISDTYRV ADLIGGQPDV       120
     TVLEVEDYIA KPKSNGYKSL HMAIEIPVFL SDRVVQVPVE LQIRTIAMDF WASLEHKIYY       180
     KYKRSVPRRL LQELTEAADV AHRLDRKMER LHNEVAGLKS VVDSDGPLSL EATDHDHGDR       240
     SQNRCGKPHN STAGPLVRNP PAGGVDVCRN TTHLTDAVLQ GNTRVGPSTA PTACRRNPNP       300
//

If you have problems or comments...

PBIL Back to PBIL home page