(data stored in ACNUC7421 zone)

EMBL: AP011115.PE91

AP011115.PE91        Location/Qualifiers
FT   CDS             78917..79477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48338"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS89"
FT                   /protein_id="BAH48338.1"
FT                   /translation="MDASKATPSTSRGLRLRLKPVQSRGFVQGAWWPRSTHLTDELPAL
FT                   LTALSRRLGHIDRIIYDENGWAPAPSRIDHAGNTVDLRHSSDQSSNTLAITGEKFGRLV
FT                   LLVVPPYTDPVFAYATIMTAASPRDVSTADELLAIGAREAEDRRLALRAQHRWESEGGA
FT                   LHHRGDKSVRPRRTGDSDRVRHG"
     MDASKATPST SRGLRLRLKP VQSRGFVQGA WWPRSTHLTD ELPALLTALS RRLGHIDRII        60
     YDENGWAPAP SRIDHAGNTV DLRHSSDQSS NTLAITGEKF GRLVLLVVPP YTDPVFAYAT       120
     IMTAASPRDV STADELLAIG AREAEDRRLA LRAQHRWESE GGALHHRGDK SVRPRRTGDS       180
     DRVRHG                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page