(data stored in ACNUC7421 zone)

EMBL: AP011115.PE92

AP011115.PE92        Location/Qualifiers
FT   CDS             80188..80616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48339"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS90"
FT                   /protein_id="BAH48339.1"
FT                   /translation="MGIVHGRSVLAAGLGITVELIDLLRYPAGVELRLALTAYGHAAQQ
FT                   ARYETRPLTDPGDPSPRWSFLRTHVRAGDLTGEADPYQAPILSTGTTRLIDFRTTPRYW
FT                   IDGIPAPVSLMVTVEWARIGLAATSSTIEIGPVPHPLP"
     MGIVHGRSVL AAGLGITVEL IDLLRYPAGV ELRLALTAYG HAAQQARYET RPLTDPGDPS        60
     PRWSFLRTHV RAGDLTGEAD PYQAPILSTG TTRLIDFRTT PRYWIDGIPA PVSLMVTVEW       120
     ARIGLAATSS TIEIGPVPHP LP                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page