(data stored in ACNUC7421 zone)

EMBL: AP011115.PE96

AP011115.PE96        Location/Qualifiers
FT   CDS             82395..82679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48343"
FT                   /db_xref="GOA:C1AS94"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS94"
FT                   /protein_id="BAH48343.1"
FT                   /translation="MSTALYFAGLSLIGIGGLGDGLIRGLNPSAHPGTHKVSMGLALAG
FT                   VLCWTVGAVVSDQPLWWKIVASVFVLTIGFLLTMRSRFLPSHQWCEPDE"
     MSTALYFAGL SLIGIGGLGD GLIRGLNPSA HPGTHKVSMG LALAGVLCWT VGAVVSDQPL        60
     WWKIVASVFV LTIGFLLTMR SRFLPSHQWC EPDE                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page