(data stored in ACNUC7421 zone)

EMBL: AP011115.PE97

AP011115.PE97        Location/Qualifiers
FT   CDS             82693..82881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48344"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS95"
FT                   /protein_id="BAH48344.1"
FT                   /translation="MYRQYILVEPPVVQHVATANTDRVGLHVPRNPVVGGSYSLRGQSV
FT                   GVIGVTTGPATRTPATC"
     MYRQYILVEP PVVQHVATAN TDRVGLHVPR NPVVGGSYSL RGQSVGVIGV TTGPATRTPA        60
     TC                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page