(data stored in ACNUC7421 zone)

EMBL: AP011115.PEPQ

AP011115.PEPQ        Location/Qualifiers
FT   CDS             complement(587390..588529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="ROP_05700"
FT                   /product="putative Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="protein synonym:prolidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48817"
FT                   /db_xref="GOA:C1ARZ0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ0"
FT                   /protein_id="BAH48817.1"
FT                   /translation="MSSLGASTSRFPTTIYADRIARAGALARDAGLDGLLITPGPDLRY
FT                   LLGSRAESFERLTCLVIPANGDTASVVVPRLELAALTESATSDLGLTVRDWVDGVDPYA
FT                   LVSGLLPSPARTAVTDAMPALHLIPLSEALGALPILATEVLRELRMVKDDAEIDALRRA
FT                   GQAIDRVHARMGEFLKVGRTEAEVAADITAAILEEGHTEAAFVIVGSGPHGADPHHEVS
FT                   ERVVESGDVVVIDIGGPVEPGYNSDSTRTYSMGEPDPGVAEKFAVLEEAQAAAVALVRP
FT                   GVTAEAVDAAARDLLAAQGLAEVFVHRTGHGIGLSVHEEPYIVSGNSIELTEGMAFSVE
FT                   PGIYFRGEWGARIEDIVVVTADGCEPVNTRPHGLTVLPG"
     MSSLGASTSR FPTTIYADRI ARAGALARDA GLDGLLITPG PDLRYLLGSR AESFERLTCL        60
     VIPANGDTAS VVVPRLELAA LTESATSDLG LTVRDWVDGV DPYALVSGLL PSPARTAVTD       120
     AMPALHLIPL SEALGALPIL ATEVLRELRM VKDDAEIDAL RRAGQAIDRV HARMGEFLKV       180
     GRTEAEVAAD ITAAILEEGH TEAAFVIVGS GPHGADPHHE VSERVVESGD VVVIDIGGPV       240
     EPGYNSDSTR TYSMGEPDPG VAEKFAVLEE AQAAAVALVR PGVTAEAVDA AARDLLAAQG       300
     LAEVFVHRTG HGIGLSVHEE PYIVSGNSIE LTEGMAFSVE PGIYFRGEWG ARIEDIVVVT       360
     ADGCEPVNTR PHGLTVLPG                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page