(data stored in ACNUC7421 zone)

EMBL: AP011115.PHES

AP011115.PHES        Location/Qualifiers
FT   CDS             complement(721323..722408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="ROP_06900"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="protein synonym:pheRS"
FT                   /note="protein synonym:phenylalanine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48937"
FT                   /db_xref="GOA:C1AT05"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT05"
FT                   /protein_id="BAH48937.1"
FT                   /translation="MAKKEGAASAGVEGGAVDASALTEDALTAAAESAEKAFASVADLD
FT                   DLAKAKVEHMGDKSPIALARRGLGALPGKEKADAGKRVNVARTRISAAFDERRAVLLAE
FT                   RDAAVLVAEAIDVTLPSQRQPVGARHPISIISEQVEDVFVAMGWEVAEGPEVETEHFNF
FT                   DALNFLPDHPARTMQDTFHIAPEGSRQVLRTHTSPVQVRTMLSREVPIYVVCPGRTFRT
FT                   DELDATHTPVFSQVEGLAVDKGLTMAHLRGTLDAFARALFGPETRTRMRPNYFPFTEPS
FT                   AEVDVWFPNKKGGAGWVEWGGCGMVNPNVLRASGIDPDVYTGFAFGMGLERTLQFRNGI
FT                   PDMRDIVEGDVRFTLPFGVQG"
     MAKKEGAASA GVEGGAVDAS ALTEDALTAA AESAEKAFAS VADLDDLAKA KVEHMGDKSP        60
     IALARRGLGA LPGKEKADAG KRVNVARTRI SAAFDERRAV LLAERDAAVL VAEAIDVTLP       120
     SQRQPVGARH PISIISEQVE DVFVAMGWEV AEGPEVETEH FNFDALNFLP DHPARTMQDT       180
     FHIAPEGSRQ VLRTHTSPVQ VRTMLSREVP IYVVCPGRTF RTDELDATHT PVFSQVEGLA       240
     VDKGLTMAHL RGTLDAFARA LFGPETRTRM RPNYFPFTEP SAEVDVWFPN KKGGAGWVEW       300
     GGCGMVNPNV LRASGIDPDV YTGFAFGMGL ERTLQFRNGI PDMRDIVEGD VRFTLPFGVQ       360
     G                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page