(data stored in ACNUC7421 zone)

EMBL: AP011115.PHET

AP011115.PHET        Location/Qualifiers
FT   CDS             complement(718769..721255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="ROP_06890"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="protein synonym:pheRS"
FT                   /note="protein synonym:phenylalanine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48936"
FT                   /db_xref="GOA:C1AT04"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT04"
FT                   /protein_id="BAH48936.1"
FT                   /translation="MRVAQSWLTEILQRATPDWDVTAEELDAGFVRVGLEVEEVDRLEP
FT                   VDGPLVVGKVLEITELTEFKKPIRFCKVDVGAAEPQGIVCGARNFAEGDLVVVALPGAV
FT                   LPGGFAIASRKTYGQVSDGMICSVAELGIGKDHSGILVLEPGTALPGADANELMGLHDT
FT                   VIELNITPDRGYCFSVRGLTRELACGFDLDFADPAAVAPSPADGEAWPIRVEPESKATR
FT                   FAARRVTGIDPNAVSPWWLQRRLLLSGVRPISPAVDVTNYVLLELGQPLHAFDAAKIRG
FT                   ELVVRRAVAGEKLTTLDETERVLDPEDVVIADDSGVLSLAGIMGGASTEVGPGTTDILL
FT                   EAATWDPLAVFKTARRHKLSSEAGKRFERVVDPEIPVAALDRAAALLVDIAGGRVESAL
FT                   TDIGEVTPHRPIHMDIDLPDRVAGVDYPTGTSARRLTQIGCSVEVGVSDSGHGQLVAAP
FT                   PSWRPDLVQPADLVEEVLRLEGLEKIPSVLPAAPAGRGLTPTQRRKRAVGRALAFSGYV
FT                   EILPPVFLPTAVFDTWGLDPEDPRRNTGRVLNPLESDRPELATTLLPGLLEVLARNVSR
FT                   GQRDLSLFGIAQVVLPGADTKPVAALPVDRRPTDEQITALLQSLPDQPVHVAVVLTGQR
FT                   EPSGPWGAGRAADATDAFAAARTVAAAAGVEFEFRAAQYLPWHPGRGAELLVDGVVVGH
FT                   AGELHPAVLERAGLPPRTSAVEIDLSALPLVENLPAPKVSPFPAVLQDVAVVVDTAVPA
FT                   AEVQAALRSGGGELLEDIRLFDVFEGEQVGEGRKSLAFALRFRGADRTLTEDEASAARD
FT                   AAVAAASAAVGAELRS"
     MRVAQSWLTE ILQRATPDWD VTAEELDAGF VRVGLEVEEV DRLEPVDGPL VVGKVLEITE        60
     LTEFKKPIRF CKVDVGAAEP QGIVCGARNF AEGDLVVVAL PGAVLPGGFA IASRKTYGQV       120
     SDGMICSVAE LGIGKDHSGI LVLEPGTALP GADANELMGL HDTVIELNIT PDRGYCFSVR       180
     GLTRELACGF DLDFADPAAV APSPADGEAW PIRVEPESKA TRFAARRVTG IDPNAVSPWW       240
     LQRRLLLSGV RPISPAVDVT NYVLLELGQP LHAFDAAKIR GELVVRRAVA GEKLTTLDET       300
     ERVLDPEDVV IADDSGVLSL AGIMGGASTE VGPGTTDILL EAATWDPLAV FKTARRHKLS       360
     SEAGKRFERV VDPEIPVAAL DRAAALLVDI AGGRVESALT DIGEVTPHRP IHMDIDLPDR       420
     VAGVDYPTGT SARRLTQIGC SVEVGVSDSG HGQLVAAPPS WRPDLVQPAD LVEEVLRLEG       480
     LEKIPSVLPA APAGRGLTPT QRRKRAVGRA LAFSGYVEIL PPVFLPTAVF DTWGLDPEDP       540
     RRNTGRVLNP LESDRPELAT TLLPGLLEVL ARNVSRGQRD LSLFGIAQVV LPGADTKPVA       600
     ALPVDRRPTD EQITALLQSL PDQPVHVAVV LTGQREPSGP WGAGRAADAT DAFAAARTVA       660
     AAAGVEFEFR AAQYLPWHPG RGAELLVDGV VVGHAGELHP AVLERAGLPP RTSAVEIDLS       720
     ALPLVENLPA PKVSPFPAVL QDVAVVVDTA VPAAEVQAAL RSGGGELLED IRLFDVFEGE       780
     QVGEGRKSLA FALRFRGADR TLTEDEASAA RDAAVAAASA AVGAELRS                    828
//

If you have problems or comments...

PBIL Back to PBIL home page