(data stored in ACNUC7421 zone)

EMBL: AP011115.PPNK

AP011115.PPNK        Location/Qualifiers
FT   CDS             complement(692234..693196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="ROP_06680"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:poly(P)/ATP NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48915"
FT                   /db_xref="GOA:C1ASY3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASY3"
FT                   /protein_id="BAH48915.1"
FT                   /translation="MSGGSSGGQQREREILLVAHPGRAEITETARRVGKIFERAGIGMR
FT                   VLVDEVDSTRIEPMDGMAADEFLVPGLEVTIVQAGPDAALGCEMVLVLGGDGTFLRAAE
FT                   LAQAASIPVLGINLGRIGFLAETEAEHLDEALGQVVRREYRIEHRMTLDVLVRVDDEII
FT                   ERGWALNEASIENRSRLGVLEVVLEVDGRPVSAFGCDGVLISTPTGSTAYAFSAGGPVV
FT                   WPELEALLVVPSNAHALFARPLVTSPESLIAVETVAGSHDGLVFCDGRRTLELPAGARV
FT                   EVVRGKEPVRWVRLDSAPFADRMVRKFELPVTGWRGRKP"
     MSGGSSGGQQ REREILLVAH PGRAEITETA RRVGKIFERA GIGMRVLVDE VDSTRIEPMD        60
     GMAADEFLVP GLEVTIVQAG PDAALGCEMV LVLGGDGTFL RAAELAQAAS IPVLGINLGR       120
     IGFLAETEAE HLDEALGQVV RREYRIEHRM TLDVLVRVDD EIIERGWALN EASIENRSRL       180
     GVLEVVLEVD GRPVSAFGCD GVLISTPTGS TAYAFSAGGP VVWPELEALL VVPSNAHALF       240
     ARPLVTSPES LIAVETVAGS HDGLVFCDGR RTLELPAGAR VEVVRGKEPV RWVRLDSAPF       300
     ADRMVRKFEL PVTGWRGRKP                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page